PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617361.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 396aa    MW: 43097.4 Da    PI: 7.5884
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617361.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.6e-18214268256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_009617361.1 214 RKKLRLSKEQSAYLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 268
                     778899***********************************************98 PP

2HD-ZIP_I/II127.46.2e-41214303191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  XP_009617361.1 214 RKKLRLSKEQSAYLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 303
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-17195268IPR009057Homeodomain-like
SuperFamilySSF466891.03E-18205271IPR009057Homeodomain-like
PROSITE profilePS5007117.167210270IPR001356Homeobox domain
SMARTSM003895.1E-16212274IPR001356Homeobox domain
PfamPF000462.0E-15214268IPR001356Homeobox domain
CDDcd000861.35E-15214271No hitNo description
PROSITE patternPS000270245268IPR017970Homeobox, conserved site
PfamPF021836.6E-11270304IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.6E-25270313IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MELGLSLGDT NTAATTRTTA AASSKSFFLS KNNITSSSSD HQNHSSKKKR KGIGFCMALG  60
INSSNGKVQE QHEDDEAEKS NGDDDEDDEH TSEEGNTPVQ LDLLPLVPVP RRNLPQSTHW  120
SSDNGSSENG SSGNGGLPAA RGFDVNRLPA AGTEEVSSPN SIASSFRMDF GLFRSANIIG  180
NKRNSDSGGG NDGGEPERAS SRASDEDENG VNTRKKLRLS KEQSAYLEES FKEHHTLNPK  240
QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCETLTEEN RRLHKELQEL  300
RALKSSNPFY MQLPATTLTM CPSCERVATT TSAAPPTTTA GTTTSKAPTP IATATATATT  360
SDSIPKAIPF LNSRPRFFPF NTTTNNPNHP HQSAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212218TRKKLRL
2262270RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-95HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617361.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466657e-94HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLM1A7650.0M1A765_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000161460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-68homeobox from Arabidopsis thaliana